PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005178m
Common NameCARUB_v10005178mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 344aa    MW: 38987.9 Da    PI: 9.9229
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005178mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.4e-32262320159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver a+dp++v++tYeg+H h+
  Carubv10005178m 262 LDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLADDPRMVITTYEGRHLHS 320
                      59*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-33247320IPR003657WRKY domain
SuperFamilySSF1182903.53E-28255321IPR003657WRKY domain
PROSITE profilePS5081129.344257322IPR003657WRKY domain
SMARTSM007749.9E-37262321IPR003657WRKY domain
PfamPF031065.0E-25263319IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
YSQPKKIKQN INRNHNQNFL SHTHTHNLKF VSLLRKRRTT EMGTINQGVS FFDESQTIIN  60
PNNSNHLGFF FSFPSHTLSS SSSTSSSSPS SLVSPFLGHH SLNSFLHNNP SSFVSHPQDP  120
INLMTNLPQS LISSLSTSKQ RDDHDGFLDL DHHRLTGSRS SQRPSPNPWA WSSQAGYGCS  180
QKNNHGSGID IDDNDDEVGD GGGGTNDDDH HHQHNSARRH EKHNTASLGG VVSSLKMKKL  240
KTRRKVREPR FCFKTLSEVD VLDDGYRWRK YGQKVVKNTQ HPRSYYRCTQ DKCRVKKRVE  300
RLADDPRMVI TTYEGRHLHS PSNHLDDDSL SSSHHSPLSN FFW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-24254319974Probable WRKY transcription factor 4
2lex_A1e-24254319974Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4211530.0AF421153.1 Arabidopsis thaliana WRKY transcription factor 13 (WRKY13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284053.10.0hypothetical protein CARUB_v10005178mg, partial
SwissprotQ9SVB71e-169WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLR0F6410.0R0F641_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G39410.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.11e-114WRKY DNA-binding protein 13